PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g48886.2.p
Common NameBRADI_3g48886, LOC100839418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 274aa    MW: 30581 Da    PI: 4.9727
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g48886.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed+ll+++v+q G g+W+++a+  g++R++k+c++rw +yl
  Bradi3g48886.2.p 15 KGPWTAQEDKLLLEYVRQQGDGRWNSVAKVTGLKRSGKSCRLRWVNYL 62
                      79********************************************97 PP

2Myb_DNA-binding47.34.7e-1568117147
                       TSSS-HHHHHHHHHHHHHTTTT....-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg....tWktIartmgkgRtlkqcksrwqky 47 
                       rg+ T++E+  +++++ ++G++    tW+tIar ++ gRt++++k++w+++
  Bradi3g48886.2.p  68 RGKITPQEERVILELHGLWGNRyalkTWSTIARSLP-GRTDNEIKNYWRTH 117
                       8999********************************.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1241062IPR017930Myb domain
SuperFamilySSF466893.63E-2713114IPR009057Homeodomain-like
SMARTSM007172.0E-151464IPR001005SANT/Myb domain
PfamPF002496.1E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-241669IPR009057Homeodomain-like
CDDcd001673.72E-111762No hitNo description
PROSITE profilePS5129422.18963122IPR017930Myb domain
SMARTSM007174.5E-1167120IPR001005SANT/Myb domain
PfamPF002492.0E-1268117IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2170120IPR009057Homeodomain-like
CDDcd001676.60E-872118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEQFGWGREE GGWRKGPWTA QEDKLLLEYV RQQGDGRWNS VAKVTGLKRS GKSCRLRWVN  60
YLRPDLKRGK ITPQEERVIL ELHGLWGNRY ALKTWSTIAR SLPGRTDNEI KNYWRTHFKK  120
GKPTSKNIER ARARFLKQRR EIMEGYPRGQ DDGEDVAASV DNTGYAAAAA AVSHDADEAT  180
VRPAAPTQDE DMEVIMPDMD EFLQYHPMSA YFLQGCCVDG GTSASASDAG SSGEIDGGAT  240
WGSLWNLDDD DVVLDDVDVV GACCWDSFGL AFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24151207106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572719.11e-173PREDICTED: myb-related protein Zm38
TrEMBLA0A0Q3M7E71e-173A0A0Q3M7E7_BRADI; Uncharacterized protein
STRINGMLOC_6786.11e-122(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.11e-62myb domain protein 79